PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 676729268
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Sisymbrieae; Sisymbrium
Family NF-YB
Protein Properties Length: 231aa    MW: 25993.1 Da    PI: 6.6274
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
676729268genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB174.51.1e-5453149197
      NF-YB   1 vreqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrelegek 97 
                vreqdrf+Pianv+rim+++lPa+akis+d+ket+qecvse+isf+t+ea+++cqre+rkti+++d+lwa+++lGf+dy+epl++yl++yreleg++
  676729268  53 VREQDRFMPIANVIRIMRRILPAHAKISDDSKETIQECVSEYISFITGEANERCQREQRKTITAEDVLWAMSKLGFDDYIEPLTLYLHRYRELEGDR 149
                69*********************************************************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.101.1E-4949149IPR009072Histone-fold
SuperFamilySSF471134.02E-3756149IPR009072Histone-fold
PfamPF008089.2E-2559123IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006151.1E-1687105No hitNo description
PROSITE patternPS00685090106IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006151.1E-16106124No hitNo description
PRINTSPR006151.1E-16125143No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009738Biological Processabscisic acid-activated signaling pathway
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0033613Molecular Functionactivating transcription factor binding
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 231 aa     Download sequence    Send to blast
MERGGFHGYR KFSLNTTNPS EPAKFLMAES NMQLSEFNQP NKTVNGGEEE CTVREQDRFM  60
PIANVIRIMR RILPAHAKIS DDSKETIQEC VSEYISFITG EANERCQREQ RKTITAEDVL  120
WAMSKLGFDD YIEPLTLYLH RYRELEGDRG ISCNAGSVSM TSGLVVKRPN GTMPEYGAYG  180
VVPGVHMAQY HYRHQNGFVY GGNEPDSKMG GSSSAASGAR VEVYPSQQHK Y
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4csr_A2e-3952144294NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
4awl_B2e-3952144294NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
1n1j_A2e-3952144193NF-YB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY1384610.0AY138461.1 Arabidopsis thaliana leafy cotyledon 1-like L1L protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013598762.11e-156PREDICTED: nuclear transcription factor Y subunit B-6-like
SwissprotQ84W661e-149NFYB6_ARATH; Nuclear transcription factor Y subunit B-6
TrEMBLA0A078FT611e-157A0A078FT61_BRANA; BnaA06g35340D protein
TrEMBLM4E8181e-157M4E818_BRARP; Uncharacterized protein
STRINGBra024924.1-P1e-156(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM98962636
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G47670.11e-149nuclear factor Y, subunit B6